Catalog No. | YP396033 |
---|---|
Species reactivity | General |
Applications | ELISA, WB |
Host species | Mouse |
Isotype | IgG2b |
Clone ID | SAA0348 |
Clonality | Monoclonal |
Target | Twin-Strep-tag, Twin Strep tag, TwinStrep tag, Streptag, Strep tag, SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK |
Purification | Protein A/G purified from cell culture supernatant. |
Form | Liquid |
Storage buffer | 0.01M PBS, pH 7.4. Please refer to the specific buffer information in the hardcopy of datasheet or the lot-specific COA. |
Stability and Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Store at 4°C short term (1-2 weeks). Store at -20°C 12 months. Store at -80°C long term. |
Note | For research use only. |
SDS-PAGE for Anti-Twin-Strep-tag Antibody (SAA0348).
+86-027-65523339
Building C, No. 666, Shen Dun Si Lu, Wuhan, 430206, China